Novus Biologicals
Manufacturer Code:NBP16905620UL
Catalog # NBP16905620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NPFFR2 (neuropeptide FF receptor 2) The peptide sequence was selected from the C terminal of NPFFR2. Peptide sequence KAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: G protein-coupled receptor 74; G-protein coupled receptor 74; G-protein coupled receptor HLWAR77; GPR74G protein-coupled receptor 74 G-protein coupled receptor 74 neuropeptide FF 2 neuropeptide FF receptor 2 Neuropeptide G-protein coupled receptor NPFF2G-protein coupled receptor HLWAR77 NPGPRHLWAR77; neuropeptide FF 2; Neuropeptide FF receptor 2; Neuropeptide G-protein coupled receptor
Gene Aliases: GPR74; HLWAR77; NPFF2; NPFFR2; NPGPR
UniProt ID: (Human) Q9Y5X5
Entrez Gene ID: (Human) 10886
Molecular Function: G-protein coupled receptor receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.