Novus Biologicals
Manufacturer Code:NBP191966
Catalog # NBP191966
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCRERRSQDSRMTFRERTERHEMQILSKP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: G protein-coupled receptor 154 G protein-coupled receptor for asthma susceptibility GPR154NPSR GPRAASRT2 G-protein coupled receptor 154 G-protein coupled receptor for asthma susceptibility G-protein coupled receptor PGR14 neuropeptide S receptor neuropeptide S receptor 1 PGR14VRR1 vasopressin receptor-related receptor 1; G-protein coupled receptor 154; G-protein coupled receptor for asthma susceptibility; G-protein coupled receptor PGR14; Neuropeptide S receptor; vasopressin receptor-related receptor 1
Gene Aliases: ASRT2; GPR154; GPRA; NPSR; NPSR1; PGR14; VRR1
UniProt ID: (Human) Q6W5P4
Entrez Gene ID: (Human) 387129
Molecular Function:
G-protein coupled receptor
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.