Novus Biologicals
Manufacturer Code:NBP16243520UL
Catalog # NBP16243520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GPAA1(glycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast)) The peptide sequence was selected from the C terminal of GPAA1. Peptide sequence LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: anchor attachment protein 1 (Gaa1p yeast) homolog GAA1 protein homolog GAA1glycophosphatidylinositol anchor attachment 1 glycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast) GPAA1P anchor attachment protein 1 homolog GPAA1P anchor attachment protein 1 homolog (yeast) GPI anchor attachment protein 1 GPI transamidase subunit hGAA1glycosylphosphatidylinositol anchor attachment 1 protein; anchor attachment protein 1 (Gaa1p, yeast) homolog; GAA1 protein homolog; glycophosphatidylinositol anchor attachment 1; Glycosylphosphatidylinositol anchor attachment 1 protein; glycosylphosphatidylinositol anchor attachment protein 1 homolog; GPAA1P anchor attachment protein 1 homolog; GPI anchor attachment protein 1; GPI transamidase subunit; hGAA1
Gene Aliases: GAA1; GPAA1; hGAA1
UniProt ID: (Human) O43292
Entrez Gene ID: (Human) 8733
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.