Novus Biologicals
Manufacturer Code:NBP180521
Catalog # NBP180521
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human GOT2. Peptide sequence AILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: aspartate aminotransferase 2; aspartate aminotransferase mitochondrial EC 2.6.1 EC 2.6.1.1 FABP-1 FABPpm Fatty acid-binding protein FLJ40994 Glutamate oxaloacetate transaminase 2 glutamic-oxaloacetic transaminase 2 mitochondrial (aspartate aminotransferase2) KAT4 KATIV kynurenine aminotransferase IV mAspAT mitAAT Plasma membrane-associated fatty acid-binding protein Transaminase A; Aspartate aminotransferase, mitochondrial; aspartate transaminase 2; FABP-1; FABPpm; Fatty acid-binding protein; Glutamate oxaloacetate transaminase 2; glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2); Kynurenine aminotransferase 4; Kynurenine aminotransferase IV; Kynurenine--oxoglutarate transaminase 4; Kynurenine--oxoglutarate transaminase IV; mAspAT; Plasma membrane-associated fatty acid-binding protein; Transaminase A
Gene Aliases: GOT2; KAT4; KATIV; KYAT4; mitAAT
UniProt ID: (Human) P00505
Entrez Gene ID: (Human) 2806
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.