Novus Biologicals
Manufacturer Code:NBP15675420UL
Catalog # NBP15675420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to C10ORF132 The peptide sequence was selected from the N terminal of C10ORF132. Peptide sequence MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: bA451M19.3 bA459F3.4 C10orf132 C10orf133 chromosome 10 open reading frame 132 chromosome 10 open reading frame 133 golgi autoantigen golgin subfamily a 7B golgin A7 family member B Golgin subfamily A member 7B MGC131701; golgi autoantigen, golgin subfamily a, 7B; golgin A7 family, member B; Golgin subfamily A member 7B
Gene Aliases: bA451M19.3; bA459F3.4; C10orf132; C10orf133; GOLGA7B
UniProt ID: (Human) Q2TAP0
Entrez Gene ID: (Human) 401647
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.