Novus Biologicals
Manufacturer Code:NBP153153
Catalog # NBP153153
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GOLGA7(golgi autoantigen golgin subfamily a 7) The peptide sequence was selected from the middle region of GOLGA7. Peptide sequence ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: GCP16MGC21096 GOLGA3AP1 GOLGA7A golgi autoantigen golgin subfamily a 7 Golgi complex-associated protein of 16 kDa Golgi complex-associated protein of 16kDa golgin A7 Golgin subfamily A member 7 HSPC041 MGC4876; golgi autoantigen, golgin subfamily a, 7; Golgi complex-associated protein of 16 kDa; Golgi complex-associated protein of 16kDa; Golgin subfamily A member 7
Gene Aliases: GCP16; GOLGA3AP1; GOLGA7; GOLGA7A; HDCKB03P; HSPC041
UniProt ID: (Human) Q7Z5G4
Entrez Gene ID: (Human) 51125
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.