Novus Biologicals
Manufacturer Code:NBP258522
Catalog # NBP258522
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LDDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRISVFSRKWNQSTARWLRRLVFQHS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.3.1.- ghrelin O-acyltransferase GOATFKSG89 membrane bound O-acyltransferase domain containing 4 Membrane-bound O-acyltransferase domain-containing protein 4 OACT4 O-acyltransferase (membrane bound) domain containing 4 O-acyltransferase domain-containing protein 4; Ghrelin O-acyltransferase; Membrane-bound O-acyltransferase domain-containing protein 4; O-acyltransferase (membrane bound) domain containing 4; O-acyltransferase domain-containing protein 4
Gene Aliases: FKSG89; GOAT; MBOAT4; OACT4
UniProt ID: (Human) Q96T53
Entrez Gene ID: (Human) 619373
Molecular Function:
acetyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.