Novus Biologicals
Manufacturer Code:NBP238477
Catalog # NBP238477
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp686O0962 G-ALPHA-o GNAO guanine nucleotide binding protein (G protein) alpha activating activitypolypeptide O guanine nucleotide binding protein alpha activating polypeptide O guanine nucleotide-binding protein G(o) subunit alpha; GO2-q chimeric G-protein; guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O; Guanine nucleotide-binding protein G(o) subunit alpha; guanine nucleotide-binding regulatory protein 2
Gene Aliases: EIEE17; G-ALPHA-o; GNAO; GNAO1; HLA-DQB1
UniProt ID: (Human) P09471
Entrez Gene ID: (Human) 2775
Molecular Function:
G-protein
enzyme modulator
heterotrimeric G-protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.