Novus Biologicals
Manufacturer Code:NBP19134720UL
Catalog # NBP19134720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human GNPTAB (NP_077288). Peptide sequence FQFGEVVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp762B226 GlcNAc phosphotransferase glucosamine (UDP-N-acetyl)-lysosomal-enzyme N-acetylglucosamine phosphotransferase GNPTA ICD KIAA1208 MGC4170 N-acetylglucosamine-1-phosphate transferase alpha and beta subunits stealth protein GNPTAB UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylglucosamine; GlcNAc phosphotransferase; GlcNAc-1-phosphotransferase subunits alpha/beta; glucosamine (UDP-N-acetyl)-lysosomal-enzyme N-acetylglucosamine phosphotransferase; N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits; N-acetylglucosamine-1-phosphotransferase subunit alpha; N-acetylglucosamine-1-phosphotransferase subunit beta; N-acetylglucosamine-1-phosphotransferase subunits alpha/beta; Stealth protein GNPTAB; UDP-N-acetylglucosamine-1-phosphotransferase subunits alpha/beta; UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylglucosamine
Gene Aliases: GNPTA; GNPTAB; ICD; KIAA1208
UniProt ID: (Human) Q3ZQK2
Entrez Gene ID: (Human) 79158
Molecular Function:
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.