Novus Biologicals
Manufacturer Code:NBP233474
Catalog # NBP233474
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LSKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDAT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.5.99.6 GlcN6P deaminase 1 glucosamine-6-phosphate deaminase 1KIAA0060HLNGNPIGNPDA glucosamine-6-phosphate isomerase glucosamine-6-phosphate isomerase 1 GNP1 GNPDA 1 GPI oscillin; glcN6P deaminase 1; Glucosamine-6-phosphate deaminase 1; Glucosamine-6-phosphate isomerase 1; GNPDA 1; Oscillin
Gene Aliases: GNP1; GNPDA; GNPDA1; GNPI; GPI; HLN; KIAA0060
UniProt ID: (Human) P46926
Entrez Gene ID: (Human) 10007
Molecular Function:
hydrolase
isomerase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.