Novus Biologicals
Manufacturer Code:NBP155307
Catalog # NBP155307
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GNB1(guanine nucleotide binding protein (G protein) beta polypeptide 1) The peptide sequence was selected from the N terminal of GNB1. Peptide sequence MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: beta subunit signal-transducing proteins GS/GI G protein beta-1 subunit guanine nucleotide binding protein (G protein) beta polypeptide 1 guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 Transducin beta chain 1; beta subunit, signal-transducing proteins GS/GI; guanine nucleotide binding protein (G protein), beta polypeptide 1; Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1; testicular tissue protein Li 72; Transducin beta chain 1
Gene Aliases: GNB1; MRD42
UniProt ID: (Human) P62873
Entrez Gene ID: (Human) 2782
Molecular Function:
G-protein
enzyme modulator
heterotrimeric G-protein
hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.