Novus Biologicals
Manufacturer Code:NBP198606
Catalog # NBP198606
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is GNA11 - C-terminal region. Peptide sequence PFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVES. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: G alpha-11; G alpha-11 GA11 GNA-11 G-protein subunit alpha-11 guanine nucleotide binding protein (G protein) alpha 11 (Gq class) Guanine nucleotide-binding protein G(y) subunit alpha guanine nucleotide-binding protein subunit alpha-11 guanine nucleotide-binding protein Gq class GNA11; G-protein subunit alpha-11; guanine nucleotide binding protein (G protein), alpha 11 (Gq class); Guanine nucleotide-binding protein G(y) subunit alpha; Guanine nucleotide-binding protein subunit alpha-11
Gene Aliases: FBH; FBH2; FHH2; GA11; GNA-11; GNA11; HHC2; HYPOC2
UniProt ID: (Human) P29992
Entrez Gene ID: (Human) 2767
Molecular Function:
G-protein
enzyme modulator
heterotrimeric G-protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.