Novus Biologicals
Manufacturer Code:NBP155168
Catalog # NBP155168
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GMPPB(GDP-mannose pyrophosphorylase B) The peptide sequence was selected from the C terminal of GMPPB. Peptide sequence RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.7.13 GDP-mannose pyrophosphorylase BKIAA1851 GTP-mannose-1-phosphate guanylyltransferase beta mannose-1-phosphate guanyltransferase beta mannose-1-phosphate guanylyltransferase; GDP-mannose pyrophosphorylase B; GTP-mannose-1-phosphate guanylyltransferase beta; Mannose-1-phosphate guanyltransferase beta
Gene Aliases: GMPPB; MDDGA14; MDDGB14; MDDGC14
UniProt ID: (Human) Q9Y5P6
Entrez Gene ID: (Human) 29925
Molecular Function: G-protein modulator RNA binding protein enzyme modulator guanyl-nucleotide exchange factor nucleic acid binding nucleotidyltransferase transferase translation factor translation initiation factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.