Novus Biologicals
Manufacturer Code:NBP189758
Catalog # NBP189758
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LQQYVAAYQQLTSEKEVLHNQLLLQTQLVDQLQQQEAQGKAVAEMARQELQETQERLEAATQQNQQLRAQLSLMAHPG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 130 kDa cis-Golgi matrix protein; 130 kDa cis-Golgi matrix protein GM130 autoantigen GM130Golgi matrix protein GM130 golgi autoantigen golgin subfamily a 2 golgin A2 Golgin subfamily A member 2 golgin-95 MGC20672 SY11 protein; GM130; GM130 autoantigen; golgi autoantigen, golgin subfamily a, 2; Golgi matrix protein GM130; Golgin subfamily A member 2; Golgin-95; SY11 protein
Gene Aliases: GM130; GOLGA2
UniProt ID: (Human) Q08379
Entrez Gene ID: (Human) 2801
Molecular Function:
membrane traffic protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.