Novus Biologicals
Manufacturer Code:NBP15478220UL
Catalog # NBP15478220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GLYATL2(glycine-N-acyltransferase-like 2) The peptide sequence was selected from the middle region of GLYATL2. Peptide sequence LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Acyl-CoA:glycine N-acyltransferase-like protein 2; Acyl-CoA:glycine N-acyltransferase-like protein 2 BXMAS2-10 EC 2.3.1.13 GATF-B glycine acyltransferase family-B glycine N-acyltransferase-like protein 2 glycine-N-acyltransferase-like 2 MGC24009; glycine acyltransferase family-B; Glycine N-acyltransferase-like protein 2; glycine-N-acyltransferase-like 2
Gene Aliases: BXMAS2-10; GATF-B; GLYATL2
UniProt ID: (Human) Q86WC3
Entrez Gene ID: (Human) 219970
Molecular Function:
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.