Novus Biologicals
Manufacturer Code:NBP169619
Catalog # NBP169619
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GLT8D2(glycosyltransferase 8 domain containing 2) The peptide sequence was selected from the C terminal of GLT8D2. Peptide sequence IRHLGWNPDARYSEHFLQEAKLLHWNGRHKPWDFPSVHNDLWESWFVPDP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.4.1 EC 2.4.1.- FLJ31494 GALA4A glycosyltransferase 8 domain containing 2 glycosyltransferase 8 domain-containing protein 2 gycosyltransferase; Glycosyltransferase 8 domain-containing protein 2
Gene Aliases: GALA4A; GLT8D2; UNQ1901/PRO4347
UniProt ID: (Human) Q9H1C3
Entrez Gene ID: (Human) 83468
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.