Novus Biologicals
Manufacturer Code:NBP179310
Catalog # NBP179310
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human GLT6D1The immunogen for this antibody is GLT6D1. Peptide sequence FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: galactosyltransferase family 6 domain containing 1; galactosyltransferase family 6 domain containing 1 galactosyltransferase family 6 domain-containing 1 glycosyltransferase 6 domain containing 1 glycosyltransferase 6 domain-containing protein 1 GT6M7; Galactosyltransferase family 6 domain-containing 1; Putative glycosyltransferase 6 domain-containing protein 1
Gene Aliases: GLT6D1; GLTDC1; GT6M7
UniProt ID: (Human) Q7Z4J2
Entrez Gene ID: (Human) 360203
Molecular Function: glycosyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.