Novus Biologicals
Manufacturer Code:NBP154773
Catalog # NBP154773
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GLS2(glutaminase 2 (liver mitochondrial)) The peptide sequence was selected from the middle region of GLS2. Peptide sequence FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: breast cell glutaminase; EC 3.5.1.2 GAbreast cell glutaminase GLSglutaminase GA glutaminase 2 (liver mitochondrial) glutaminase I glutaminase liver isoform mitochondrial hLGA LGA L-glutaminase L-glutamine amidohydrolase MGC71567 phosphate-activated glutaminase phosphate-dependent glutaminase truncated glutaminase 2; GLS; glutaminase 2 (liver, mitochondrial); glutaminase I; Glutaminase liver isoform, mitochondrial; L-glutaminase; L-glutamine amidohydrolase; phosphate-activated glutaminase; phosphate-dependent glutaminase
Gene Aliases: GA; GLS; GLS2; hLGA; LGA
UniProt ID: (Human) Q9UI32
Entrez Gene ID: (Human) 27165
Molecular Function:
hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.