Novus Biologicals
Manufacturer Code:NBP15669120UL
Catalog # NBP1566920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GK2(glycerol kinase 2) The peptide sequence was selected from the C terminal of GK2. Peptide sequence QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP:glycerol 3-phosphotransferase 2; EC 2.7.1.30 GK 2 GKP2 GKTAATP:glycerol 3-phosphotransferase 2 Glycerokinase 2 glycerol kinase 2 glycerol kinase pseudogene 2 glycerol kinase testis specific 2 Glycerol kinase testis specific 2; GK 2; glycerokinase 2; Glycerol kinase 2; glycerol kinase pseudogene 2; glycerol kinase testis specific 2; Glycerol kinase, testis specific 2; testis tissue sperm-binding protein Li 77m
Gene Aliases: GK2; GKP2; GKTA
UniProt ID: (Human) Q14410
Entrez Gene ID: (Human) 2712
Molecular Function:
carbohydrate kinase
kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.