Novus Biologicals
Manufacturer Code:NBP15305020UL
Catalog # NBP15305020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GGPS1(geranylgeranyl diphosphate synthase 1) The peptide sequence was selected from the middle region of GGPS1 (NP_001032354). Peptide sequence LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: (2E,6E)-farnesyl diphosphate synthase; 6E)-farnesyl diphosphate synthase Dimethylallyltranstransferase EC 2.5.1.1 EC 2.5.1.10 EC 2.5.1.29 Farnesyl diphosphate synthase Farnesyltranstransferase Geranylgeranyl diphosphate synthase geranylgeranyl diphosphate synthase 1 geranylgeranyl pyrophosphate synthase geranyltranstransferase GGPP synthase GGPPS GGPPS1farnesyltranstransferase GGPPSase; Dimethylallyltranstransferase; Farnesyl diphosphate synthase; Farnesyltranstransferase; Geranylgeranyl diphosphate synthase; Geranylgeranyl pyrophosphate synthase; Geranyltranstransferase; GGPP synthase; GGPPSase
Gene Aliases: GGPPS; GGPPS1; GGPS1
UniProt ID: (Human) O95749
Entrez Gene ID: (Human) 9453
Molecular Function:
acyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.