Novus Biologicals
Manufacturer Code:NBP156688
Catalog # NBP156688
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GFPT2(glutamine-fructose-6-phosphate transaminase 2) The peptide sequence was selected from the middle region of GFPT2 (NP_005101). Peptide sequence TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: D-fructose-6-phosphate amidotransferase 2; D-fructose-6-phosphate amidotransferase 2 FLJ10380 GFAT 2 GFAT2EC 2.6.1.16 glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 2 glutamine: fructose-6-phosphate aminotransferase 2 Glutamine:fructose 6 phosphate amidotransferase 2 glutamine-fructose-6-phosphate transaminase 2 Hexosephosphate aminotransferase 2; GFAT 2; glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 2; Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2; glutamine: fructose-6-phosphate aminotransferase 2; glutamine:fructose 6 phosphate amidotransferase 2; Glutamine:fructose-6-phosphate amidotransferase 2; Hexosephosphate aminotransferase 2
Gene Aliases: GFAT; GFAT 2; GFAT2; GFPT2
UniProt ID: (Human) O94808
Entrez Gene ID: (Human) 9945
Molecular Function: transaminase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.