Novus Biologicals
Manufacturer Code:NBP190187
Catalog # NBP190187
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ALRFAD-linked sulfhydryl oxidase ALR Augmenter of liver regeneration EC 1.8.3.2 ERV1 homolog ERV1hepatopoietin protein erv1-like growth factor growth factor augmenter of liver regeneration growth factor erv1 (S. cerevisiae)-like (augmenter of liver regeneration) Hepatopoietin hERV1 HERV1hepatic regenerative stimulation substance HPO HPO1 HPO2 HSS truncated augmenter of liver regeneration; Augmenter of liver regeneration; ERV1 homolog; erv1-like growth factor; FAD-linked sulfhydryl oxidase ALR; hepatic regenerative stimulation substance; Hepatopoietin; hepatopoietin protein; hERV1
Gene Aliases: ALR; ERV1; GFER; HERV1; HPO; HPO1; HPO2; HSS
UniProt ID: (Human) P55789
Entrez Gene ID: (Human) 2671
Molecular Function: oxidase oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.