Novus Biologicals
Manufacturer Code:NBP261934
Catalog # NBP261934
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
ELISA (ELISA) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Mouse |
Class | Monoclonal |
Type | Antibody |
Clone | 53/1 |
Immunogen | Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9 |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Mouse Monoclonal Antibody
Protein Aliases: GDF-9; GDF9 GDF-9 growth differentiation factor 9 growth/differentiation factor 9; Growth/differentiation factor 9
Gene Aliases: GDF9
UniProt ID: (Human) O60383
Entrez Gene ID: (Human) 2661
Molecular Function:
growth factor
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.