Novus Biologicals
Manufacturer Code:NBP287493
Catalog # NB035115
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence IGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4°C short term. Aliquot and store at -20°:C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: GCE glycine cleavage system H protein mitochondrial glycine cleavage system protein H (aminomethyl carrier) lipoic acid-containing protein mitochondrial glycine cleavage system H-protein NKH; Glycine cleavage system H protein, mitochondrial; glycine cleavage system protein H (aminomethyl carrier); Lipoic acid-containing protein; mitochondrial glycine cleavage system H-protein
Gene Aliases: GCE; GCSH; NKH
UniProt ID: (Human) P23434
Entrez Gene ID: (Human) 2653
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.