Novus Biologicals
Manufacturer Code:NBP185875
Catalog # NBP185875
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1,4-alpha-glucan-branching enzyme; 14-alpha-glucan-branching enzyme amylo-(14 to 16) transglucosidase amylo-(14 to 16) transglycosylase Brancher enzyme EC 2.4.1.18 GBE glucan (14-alpha) branching enzyme 1 glycogen branching enzyme Glycogen-branching enzyme; amylo-(1,4 to 1,6) transglucosidase; amylo-(1,4 to 1,6) transglycosylase; Brancher enzyme; glycogen branching enzyme; Glycogen-branching enzyme
Gene Aliases: APBD; GBE; GBE1; GSD4
UniProt ID: (Human) Q04446
Entrez Gene ID: (Human) 2632
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.