Novus Biologicals
Manufacturer Code:NBP19840220UL
Catalog # NBP19840220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is GATC - N-terminal region. Peptide sequence GLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ37000 gatC glutamyl-tRNA(Gln) amidotransferase subunit C homolog (bacterial) MGC12993815E1.2gatC-like protein Protein 15E1.2; GATC; Glu-AdT subunit C; Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial; glutamyl-tRNA(Gln) amidotransferase, subunit C homolog; Protein 15E1.2
Gene Aliases: 15E1.2; GATC
UniProt ID: (Human) O43716
Entrez Gene ID: (Human) 283459
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.