Novus Biologicals
Manufacturer Code:NBP15460220UL
Catalog # NBP15460220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GARS(glycyl-tRNA synthetase) The peptide sequence was selected from the middle region of GARS. Peptide sequence IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AP-4-A synthetase; AP-4-A synthetase Charcot-Marie-Tooth neuropathy 2D Charcot-Marie-Tooth neuropathy neuronal type D Diadenosine tetraphosphate synthetase DSMAV glycine tRNA ligase Glycine--tRNA ligase glycyl-tRNA synthetase GlyRSEC 6.1.1.14 HMN5 SMAD1CMT2D; Ap4A synthetase; Charcot-Marie-Tooth neuropathy 2D; Charcot-Marie-Tooth neuropathy, neuronal type, D; Diadenosine tetraphosphate synthetase; glycine tRNA ligase; Glycine--tRNA ligase; Glycyl-tRNA synthetase; Glycyl-tRNA synthetase 1; GlyRS
Gene Aliases: CMT2D; DSMAV; GARS; GARS1; GlyRS; HMN5; SMAD1
UniProt ID: (Human) P41250
Entrez Gene ID: (Human) 2617
Molecular Function: aminoacyl-tRNA synthetase ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.