Novus Biologicals
Manufacturer Code:NBP154819
Catalog # NBP154819
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GAMT(guanidinoacetate N-methyltransferase) The peptide sequence was selected from the N terminal of GAMT. Peptide sequence MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.1.1.2 guanidinoacetate N-methyltransferase PIG2 TP53I2; epididymis secretory protein Li 20; Guanidinoacetate N-methyltransferase
Gene Aliases: CCDS2; GAMT; HEL-S-20; PIG2; TP53I2
UniProt ID: (Human) Q14353
Entrez Gene ID: (Human) 2593
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.