Novus Biologicals
Manufacturer Code:NBP17932620UL
Catalog # NBP17932620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is Gal3st4. Peptide sequence RPLQFGSAKVLGYVLQSGLNQKDKEECERLATPELQYKDKLDAKQFPPTV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Beta-galactose-3-O-sulfotransferase 4; beta-galactose-3-O-sulfotransferase, 4; EC 2.8.2.- GAL3ST-4 galactose-3-O-sulfotransferase 44Beta-galactose-3-O-sulfotransferase 4 Gal-beta-13-GalNAc 3'-sulfotransferase galbeta1-3GalNAc 3'-sulfotransferase; Gal-beta-1,3-GalNAc 3'-sulfotransferase; Gal3ST-4; Galactose-3-O-sulfotransferase 4; galbeta1-3GalNAc 3'-sulfotransferase
Gene Aliases: GAL3ST-4; GAL3ST4; PP6968
UniProt ID: (Human) Q96RP7
Entrez Gene ID: (Human) 79690
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.