Novus Biologicals
Manufacturer Code:NBP169307
Catalog # NBP169307
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GAL3ST3(galactose-3-O-sulfotransferase 3) The peptide sequence was selected from the C terminal of GAL3ST3. Peptide sequence VDIMGYDLPGGGAGPATEACLKLAMPEVQYSNYLLRKQKRRGGARARPEP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Beta-galactose-3-O-sulfotransferase 3; Beta-galactose-3-O-sulfotransferase 3 EC 2.8.2.- GAL3ST2galactose 3'-sulfotransferase Gal3ST3 GAL3ST-3 galactose-3-O-sulfotransferase 3 Gal-beta-1 3-GalNAc 3'-sulfotransferase 3 galbeta1-3GalNAc 3'-sulfotransferase 3 MGC142112 MGC142114; Gal-beta-1, 3-GalNAc 3'-sulfotransferase 3; Gal3ST-3; Gal3ST3; galactose 3'-sulfotransferase; Galactose-3-O-sulfotransferase 3; galbeta1-3GalNAc 3'-sulfotransferase 3
Gene Aliases: GAL3ST-3; GAL3ST2; GAL3ST3
UniProt ID: (Human) Q96A11
Entrez Gene ID: (Human) 89792
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.