Novus Biologicals
Manufacturer Code:NBP18239020UL
Catalog # NBP18239020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide towards GABA A receptor pi. Peptide sequence GFENLTAGYNKFLRPNFGGDPVRIALTLDIASISSISESNMDYTATIYLR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: GABA(A) receptor subunit pi; GABA(A) receptor subunit pi gamma-aminobutyric acid (GABA) A receptor pi gamma-aminobutyric acid receptor subunit pi MGC126386 MGC126387; GABA(A) receptor, pi; gamma-aminobutyric acid (GABA) A receptor, pi; Gamma-aminobutyric acid receptor subunit pi
Gene Aliases: GABRP
UniProt ID: (Human) O00591
Entrez Gene ID: (Human) 2568
Molecular Function:
GABA receptor
acetylcholine receptor
ion channel
ligand-gated ion channel
receptor
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.