Novus Biologicals
Manufacturer Code:NBP191918
Catalog # NBP191918
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ESTGFLGNISSASHGLCSSPAEPSCSHQHLPQEQEPTSEPPVSHCVPPTWPIPAPPGCLRSHQHASQRAE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: GAB2-like; GAB2-like GRB2-associated binder 2-like GRB2-associated binder 2-like protein GRB2-associated binder 4 GRB2-associated binding protein family member 4 GRB2-associated-binding protein 2-like GRB2-associated-binding protein 4 Growth factor receptor bound protein 2-associated protein 4; GRB2-associated binder 2-like; GRB2-associated binder 2-like protein; GRB2-associated binder 4; GRB2-associated binding protein family, member 4; GRB2-associated-binding protein 2-like; GRB2-associated-binding protein 4; Growth factor receptor bound protein 2-associated protein 4
Gene Aliases: GAB4
UniProt ID: (Human) Q2WGN9
Entrez Gene ID: (Human) 128954
Molecular Function:
transmembrane receptor regulatory/adaptor protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.