Novus Biologicals
Manufacturer Code:NBP180533
Catalog # NBP180533
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide corresponding to aa 10-59 in the N-terminal region of mouse G6PC (NP_032087). Peptide sequence DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.1.3.9 G6Pase G-6-Pase G6Pase-alpha G6PT glucose-6-phosphatase Glucose-6-phosphatase alpha glucose-6-phosphatase catalytic (glycogen storage disease type I von Gierkedisease) glucose-6-phosphatase catalytic subunit GSD1 GSD1a MGC163350; G-6-Pase; G6Pase-alpha; Glucose-6-phosphatase; Glucose-6-phosphatase alpha; Glucose-6-phosphatase catalytic subunit 1; glucose-6-phosphatase, catalytic subunit
Gene Aliases: G6Pase; G6PC; G6PC1; G6PT; GSD1; GSD1a
UniProt ID: (Human) P35575
Entrez Gene ID: (Human) 2538
Molecular Function: carbohydrate phosphatase hydrolase phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.