Novus Biologicals
Manufacturer Code:NBP189907
Catalog # NBP189907
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LLDIENKGYLNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTVTTILIDLNGFWT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C14orf10 chromosome 14 open reading frame 10 FLJ20644 G4-1 G5pr protein phosphatase 2 (formerly 2A) regulatory subunit B'' gamma protein phosphatase 2 regulatory subunit B'' gamma Protein phosphatase subunit G5PR rhabdomyosarcoma antigen MU-RMS-40.6A Rhabdomyosarcoma antigen MU-RMS-40.6A/6C rhabdomyosarcoma antigen Mu-RMS-40.6C serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma; protein phosphatase 2 (formerly 2A), regulatory subunit B''; protein phosphatase 2 regulatory subunit B'', gamma; protein phosphatase 2, regulatory subunit B'', gamma; Protein phosphatase subunit G5PR; rhabdomyosarcoma antigen MU-RMS-40.6A; Rhabdomyosarcoma antigen MU-RMS-40.6A/6C; rhabdomyosarcoma antigen Mu-RMS-40.6C; Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma
Gene Aliases: C14orf10; G4-1; G5PR; PPP2R3C
UniProt ID: (Human) Q969Q6
Entrez Gene ID: (Human) 55012
Molecular Function:
hydrolase
phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.