Novus Biologicals
Manufacturer Code:NBP182977
Catalog # NBP182977
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:HNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQPSPEPVQENANSGYYEAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: G3BP-2; G3BP-2 GAP SH3 domain-binding protein 2 GTPase activating protein (SH3 domain) binding protein 2 KIAA0660 ras GTPase-activating protein-binding protein 2 Ras-GTPase activating protein SH3 domain-binding protein 2; GAP SH3 domain-binding protein 2; GTPase activating protein (SH3 domain) binding protein 2; Ras GTPase-activating protein-binding protein 2; Ras-GTPase activating protein SH3 domain-binding protein 2
Gene Aliases: G3BP2; KIAA0660
UniProt ID: (Human) Q9UN86
Entrez Gene ID: (Human) 9908
Molecular Function:
RNA binding protein
nucleic acid binding
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.