Novus Biologicals
Manufacturer Code:NBP158349
Catalog # NBP158349
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GNAS(GNAS complex locus) The peptide sequence was selected from the N terminal of GNAS. Peptide sequence VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Adenylate cyclase-stimulating G alpha protein; Adenylate cyclase-stimulating G alpha protein AHO Alternative gene product encoded by XL-exon Extra large alphas protein GNAS complex locus GNAS1GSA GNASXL GPSAC20orf45 GSP guanine nucleotide binding protein (G protein) alpha stimulating activitypolypeptide 1 guanine nucleotide regulatory protein guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas MGC33735 NESP NESP55 neuroendocrine secretory protein PHP1A PHP1B PHP1C POH protein ALEX SCG6 secretogranin VI XLalphas; Alternative gene product encoded by XL-exon; Extra large alphas protein; G protein subunit alpha S; GPIPIRRH peptide; guanine nucleotide binding protein (G protein), alpha stimulating activity polypeptide 1; guanine nucleotide regulatory protein; Guanine nucleotide-binding protein G(s) subunit alpha isoforms short; Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas; LHAL tetrapeptide; NESP55; neuroendocrine secretory protein; Neuroendocrine secretory protein 55; Protein ALEX; secretogranin VI; XLalphas
Gene Aliases: AHO; C20orf45; GNAS; GNAS1; GPSA; GSA; GSP; NESP; POH; SCG6; SgVI
UniProt ID: (Human) P84996
Entrez Gene ID: (Human) 2778
Molecular Function:
G-protein
enzyme modulator
heterotrimeric G-protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.