Novus Biologicals
Manufacturer Code:NBP159825
Catalog # NBP159825
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FURIN(furin (paired basic amino acid cleaving enzyme)) The peptide sequence was selected from the N terminal of FURIN. Peptide sequence RDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dibasic processing enzyme; Dibasic-processing enzyme; Dibasic-processing enzyme EC 3.4.21 EC 3.4.21.75 FURdibasic processing enzyme furin (paired basic amino acid cleaving enzyme) furin membrane associated receptor protein PACEFES upstream region paired basic amino acid cleaving enzyme (furin membrane associated receptorprotein) Paired basic amino acid residue-cleaving enzyme PCSK3furin proprotein convertase subtilisin/kexin type 3 SPC1; FES upstream region; Furin; furin (paired basic amino acid cleaving enzyme); furin, membrane associated receptor protein; PACE; Paired basic amino acid residue-cleaving enzyme; proprotein convertase subtilisin/kexin type 3
Gene Aliases: FUR; FURIN; PACE; PCSK3; SPC1
UniProt ID: (Human) P09958
Entrez Gene ID: (Human) 5045
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.