Novus Biologicals
Manufacturer Code:NBP153110
Catalog # NBP153110
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FAH(fumarylacetoacetate hydrolase (fumarylacetoacetase)) The peptide sequence was selected from the C terminal of FAH. Peptide sequence AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Beta-diketonase; beta-diketonase EC 3.7.1.2 FAA fumarylacetoacetase Fumarylacetoacetate hydrolase fumarylacetoacetate hydrolase (fumarylacetoacetase); FAA; Fumarylacetoacetase; Fumarylacetoacetate hydrolase; fumarylacetoacetate hydrolase (fumarylacetoacetase)
Gene Aliases: FAH
UniProt ID: (Human) P16930
Entrez Gene ID: (Human) 2184
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.