Novus Biologicals
Manufacturer Code:NBP180775
Catalog # NBP180775
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alpha (1,2) fucosyltransferase; alpha (12) fucosyltransferase Alpha(12)FT 2 alpha(12)FT2 B12QTL1 EC 2.4.1.69 Fucosyltransferase 2 fucosyltransferase 2 (secretor status included) galactoside 2-alpha-L-fucosyltransferase 2 GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2 Se SE2 SEC2SE Secretor blood group alpha-2-fucosyltransferase Secretor factor sej; Alpha(1,2)FT 2; alpha(1,2)FT2; Fucosyltransferase 2; fucosyltransferase 2 (secretor status included); Galactoside alpha-(1,2)-fucosyltransferase 2; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2; Se; SE2; Secretor blood group alpha-2-fucosyltransferase; Secretor factor; Type 1 galactoside alpha-(1,2)-fucosyltransferase FUT2; Type 2 galactoside alpha-(1,2)-fucosyltransferase FUT2
Gene Aliases: B12QTL1; FUT2; SE; Se2; SEC2; sej
UniProt ID: (Human) Q10981
Entrez Gene ID: (Human) 2524
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.