Novus Biologicals
Manufacturer Code:NBP169468
Catalog # NBP169468
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FZD6(frizzled homolog 6 (Drosophila)) The peptide sequence was selected from the middle region of FZD6. Peptide sequence HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: frizzled (Drosophila) homolog 6 frizzled homolog 6 (Drosophila) frizzled-6 fz-6 FZ6 HFZ6 seven transmembrane helix receptor; frizzled 6, seven transmembrane spanning receptor; frizzled family receptor 6; frizzled homolog 6; Frizzled-6; Fz-6; seven transmembrane helix receptor
Gene Aliases: FZ-6; FZ6; FZD6; HFZ6; NDNC10
UniProt ID: (Human) O60353
Entrez Gene ID: (Human) 8323
Molecular Function:
G-protein coupled receptor
receptor
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.