Novus Biologicals
Manufacturer Code:NBP257807
Catalog # NBP257807
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CD344; CD344 CD344 antigen EVR1 exudative vitreoretinopathy 1 FEVR frizzled (Drosophila) homolog 4 frizzled homolog 4 (Drosophila) frizzled-4 Fz-4 FZD4S FzE4 GPCR hFz4 MGC34390 WNT receptor frizzled-4; frizzled 4, seven transmembrane spanning receptor; frizzled family receptor 4; frizzled homolog 4; Frizzled-4; Fz-4; FzE4; WNT receptor frizzled-4
Gene Aliases: CD344; EVR1; FEVR; Fz-4; Fz4; FZD4; FZD4S; FzE4; GPCR; hFz4
UniProt ID: (Human) Q9ULV1
Entrez Gene ID: (Human) 8322
Molecular Function:
G-protein coupled receptor
receptor
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.