Novus Biologicals
Manufacturer Code:NBP159353
Catalog # NBP159353
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FMO4(flavin containing monooxygenase 4) The peptide sequence was selected from the N terminal of FMO4. Peptide sequence MVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPEGFQGKRVLVIGLG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Dimethylaniline monooxygenase [N-oxide-forming] 4; dimethylaniline monooxygenase [N-oxide-forming] 4 Dimethylaniline oxidase 4 EC 1.14.13.8 flavin containing monooxygenase 4 FMO 4 FMO2 Hepatic flavin-containing monooxygenase 4; Dimethylaniline oxidase 4; FMO 4; Hepatic flavin-containing monooxygenase 4
Gene Aliases: FMO2; FMO4
UniProt ID: (Human) P31512
Entrez Gene ID: (Human) 2329
Molecular Function:
oxidoreductase
oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.