Novus Biologicals
Manufacturer Code:NBP157272
Catalog # NBP157272
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FBL (fibrillarin) The peptide sequence was selected from the N terminal of FBL. Peptide sequence GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 34 kDa nucleolar scleroderma antigen; 34-kD nucleolar scleroderma antigen; EC 2.1.134-kD nucleolar scleroderma antigen EC 2.1.1.- EC 2.1.1.37 FIB FIB134 kDa nucleolar scleroderma antigen fibrillarin FLRNrRNA 2'-O-methyltransferase fibrillarin RNA U3 small nucleolar interacting protein 1 RNU3IP1; Histone-glutamine methyltransferase; RNA, U3 small nucleolar interacting protein 1; rRNA 2'-O-methyltransferase fibrillarin; U6 snRNA 2'-O-methyltransferase fibrillarin
Gene Aliases: FBL; FIB; FIB1; FLRN; RNU3IP1
UniProt ID: (Human) P22087
Entrez Gene ID: (Human) 2091
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.