Novus Biologicals
Manufacturer Code:NBP189034
Catalog # NBP189034
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAH |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ALPS1A Apo-1 APO-1 cell surface antigen apoptosis antigen 1 apoptosis signaling receptor FAS Apoptosis-mediating surface antigen FAS APT1 CD95 CD95 antigen Fas (TNF receptor superfamily member 6) Fas AMA FAS1 FASLG receptor FASTM mutant tum; Apo-1 antigen; APO-1 cell surface antigen; apoptosis antigen 1; apoptosis signaling receptor FAS; Apoptosis-mediating surface antigen FAS; CD95; CD95 antigen; Fas (TNF receptor superfamily, member 6); Fas AMA; FASLG receptor; TNF receptor superfamily member 6; Tumor necrosis factor receptor superfamily member 6; tumor necrosis factor receptor superfamily, member 6
Gene Aliases: ALPS1A; APO-1; APT1; CD95; FAS; FAS1; FASTM; TNFRSF6
UniProt ID: (Human) P25445
Entrez Gene ID: (Human) 355
Molecular Function:
cytokine receptor
receptor
tumor necrosis factor receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.