Novus Biologicals
Manufacturer Code:NBP157936
Catalog # NBP157936
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FUT6(fucosyltransferase 6 (alpha (13) fucosyltransferase)) The peptide sequence was selected from the C terminal of FUT6. Peptide sequence YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6; alpha-(13)-fucosyltransferase EC 2.4.1 FCT3AFuc-TVI FLJ40754 FT1A Fucosyltransferase 6 fucosyltransferase 6 (alpha (13) fucosyltransferase) Fucosyltransferase VI FucT-VIEC 2.4.1.65 Galactoside 3-L-fucosyltransferase; Fuc-TVI; Fucosyltransferase 6; fucosyltransferase 6 (alpha (1,3) fucosyltransferase); Fucosyltransferase VI; Galactoside 3-L-fucosyltransferase
Gene Aliases: FCT3A; FT1A; Fuc-TVI; FucT-VI; FUT6
UniProt ID: (Human) P51993
Entrez Gene ID: (Human) 2528
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.