Novus Biologicals
Manufacturer Code:NBP231571
Catalog # NBP231571
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LGKFERKEFKSSSLQDGHTKMEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHH |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alpha (1,3) fucosyltransferase; alpha 1,3-fucosyl transferase; alpha 13-fucosyl transferase alpha-(13)-fucosyltransferase 10 EC 2.4.1 EC 2.4.1.- Fucosyltransferase 10 fucosyltransferase 10 (alpha (13) fucosyltransferase) Fucosyltransferase X Fuc-TX FucT-X Galactoside 3-L-fucosyltransferase 10 MGC11141; Alpha-(1,3)-fucosyltransferase 10; Fuc-TX; Fucosyltransferase 10; fucosyltransferase 10 (alpha (1,3) fucosyltransferase); Fucosyltransferase X; fucT-X; Galactoside 3-L-fucosyltransferase 10
Gene Aliases: FUCTX; FUT10
UniProt ID: (Human) Q6P4F1
Entrez Gene ID: (Human) 84750
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.