Novus Biologicals
Manufacturer Code:NBP231745
Catalog # NBP231745
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MAASSQGNFEGDIESVDLAEFAKQQPWWRKLFGPESGLSAEKYSVATHLFIG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cervical cancer oncogene 3; cervical cancer oncogene 3 Cervical cancer proto-oncogene 3 protein DC44 FLJ33773 FUN14 domain containing 2 FUN14 domain-containing protein 2 HCBP6MGC131676 HCC3 HCC-3 Hepatitis C virus core-binding protein 6 MGC2495 PD03104; Cervical cancer proto-oncogene 3 protein; FUN14 domain-containing protein 2; HCC-3; Hepatitis C virus core-binding protein 6
Gene Aliases: DC44; FUNDC2; HCBP6; HCC3; PD03104
UniProt ID: (Human) Q9BWH2
Entrez Gene ID: (Human) 65991
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.