Novus Biologicals
Manufacturer Code:NBP257530
Catalog # NBP257530
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KAVLQEEQANLWFSKGSFAGIEDDADEALEISQAQLLFENRRKGRQQQQKQQLPQTPPSCLKTE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2'-O-ribose RNA methyltransferase SPB1 homolog; EC 2.1.1 EC 2.1.1.- EPCS3 FLJ20062 FtsJ homolog 3 (E. coli) Protein ftsJ homolog 3 putative rRNA methyltransferase 3 rRNA (uridine-2'-O-)-methyltransferase 3; FTSJ3; pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3; Protein ftsJ homolog 3; Putative rRNA methyltransferase 3; rRNA (uridine-2'-O-)-methyltransferase 3; SPB1 RNA methyltransferase homolog
Gene Aliases: EPCS3; FTSJ3; SB92; SPB1
UniProt ID: (Human) Q8IY81
Entrez Gene ID: (Human) 117246
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.