Novus Biologicals
Manufacturer Code:NBP169021
Catalog # NBP169021
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to Fto (fat mass and obesity associated) The peptide sequence was selected from the N terminal of Fto. Peptide sequence MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AlkB homolog 9; Alpha-ketoglutarate-dependent dioxygenase FTO; alpha-ketoglutarate-dependent dioxygenase FTO EC 1.14.11.- fat mass and obesity associated Fat mass and obesity-associated protein KIAA1752protein fto MGC5149; Fat mass and obesity-associated protein; m6A(m)-demethylase FTO; mRNA (2'-O-methyladenosine-N(6)-)-demethylase FTO; mRNA N(6)-methyladenosine demethylase FTO; tRNA N1-methyl adenine demethylase FTO; U6 small nuclear RNA (2'-O-methyladenosine-N(6)-)-demethylase FTO; U6 small nuclear RNA N(6)-methyladenosine-demethylase FTO
Gene Aliases: ALKBH9; BMIQ14; FTO; GDFD; KIAA1752
UniProt ID: (Human) Q9C0B1
Entrez Gene ID: (Human) 79068
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.