Novus Biologicals
Manufacturer Code:NBP191910
Catalog # NBP191910
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dJ106I20.3 Fox-1 homolog B fox-1 homologue FOX2Fox-2 fxh hexaribonucleotide binding protein 2 Hexaribonucleotide-binding protein 2 HRNBP2FOX-2 RBM9RTAHNRBP2 Repressor of tamoxifen transcriptional activity RNA binding motif protein 9 RNA binding protein fox-1 homolog 2 RNA binding protein fox-1 homolog (C. elegans) 2 RNA-binding motif protein 9 RNA-binding protein 9; Fox-1 homolog B; fox-1 homologue; Hexaribonucleotide-binding protein 2; Repressor of tamoxifen transcriptional activity; RNA binding protein fox-1 homolog 2; RNA binding protein, fox-1 homolog (C. elegans) 2; RNA-binding motif protein 9; RNA-binding protein 9
Gene Aliases: dJ106I20.3; Fox-2; FOX2; fxh; HNRBP2; HRNBP2; RBFOX2; RBM9; RTA
UniProt ID: (Human) O43251
Entrez Gene ID: (Human) 23543
Molecular Function: RNA binding protein nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.